Zymogen Granule Membrane Protein 16 Human, Sheep Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD184229100	0.1 mg	$277 / $243 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human Zymogen Granule Membrane Protein 16.

Amino Acid Sequence

The immunization antigen (17.9 kDa) is a protein containing 161 AA of recombinant Human Zymogen Granule Membrane Protein 16. N-terminal His-tag, 10 extra AA.

MKHHHHHHASNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Zymogen Granule Membrane Protein 16.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Oncology, Others

Summary

Zymogen granule membrane protein 16 (ZG16) is a 16 kDa protein first identified by immunoscreening of a rat pancreatic cDNA expression library with a polyspecific antiserum raised against purified zymogen granule membranes (ZGM). ZG16 displays sequence homology especially in the carbohydrate recognition domain to the plant lectin jacalin, which recognizes terminal galactose attached to N-acetylgalactosamine by a β1–3 linkage. According to its sequence homology with this lectin, ZG16 was considered a secretory lectin ZG16. Sequence analyses uncovered that ZG16 is highly conserved amongst mammals but also appears in many other species. Rat ZG16 was found to be highly expressed in pancreas, colon, and duodenum, where the protein was localized in the zymogen granule of pancreas. The previous reports indicated that rat ZG16 took part in the formation of zymogen granule by mediating the digested enzymes to the zymogen granule membrane in pancreatic acinar cells. Human ZG16 was shown to be highly expressed in adult liver and moderately expressed in intestine (jejunum, ileum) and colon. Moreover, ZG16 is also weakly expressed in pedunculus cerebellaris but not in other brain’s regions. Owing to the specific expression pattern in human liver, ZG16 was evaluated in hepatocellular carcinoma (HCC), a common cancer worldwide (it was found that human ZG16 was significantly down-regulated in HCC). ZG16 protein took part also in several secretions of glycoproteins (the secretion of human ZG16 would be affected when the synthesis of glycans was inhibited with inhibitor or without glucose in cell culture).

Summary References (7)

References to Zymogen granule membrane protein 16

Kanagawa M, Satoh T, Ikeda A, Nakano Y, Yagi H, Kato K, Kojima-Aikawa K, Yamaguchi Y. Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related beta-prism fold. Biochem Biophys Res Commun. 2011 Jan 7;404 (1):201-5
Kleene R, Dartsch H, Kern HF. The secretory lectin ZG16p mediates sorting of enzyme proteins to the zymogen granule membrane in pancreatic acinar cells. Eur J Cell Biol. 1999 Feb;78 (2):79-90
Schmidt K, Dartsch H, Linder D, Kern HF, Kleene R. A submembranous matrix of proteoglycans on zymogen granule membranes is involved in granule formation in rat pancreatic acinar cells. J Cell Sci. 2000 Jun;113 ( Pt 12):2233-42
Schmidt K, Schrader M, Kern HF, Kleene R. Regulated apical secretion of zymogens in rat pancreas. Involvement of the glycosylphosphatidylinositol-anchored glycoprotein GP-2, the lectin ZG16p, and cholesterol-glycosphingolipid-enriched microdomains. J Biol Chem. 2001 Apr 27;276 (17):14315-23
Tateno H, Yabe R, Sato T, Shibazaki A, Shikanai T, Gonoi T, Narimatsu H, Hirabayashi J. Human ZG16p recognizes pathogenic fungi through non-self polyvalent mannose in the digestive system. Glycobiology. 2012 Feb;22 (2):210-20
Wasle B, Edwardson JM. The regulation of exocytosis in the pancreatic acinar cell. Cell Signal. 2002 Mar;14 (3):191-7
Zhou YB, Cao JB, Yang HM, Zhu H, Xu ZG, Wang KS, Zhang X, Wang ZQ, Han ZG. hZG16, a novel human secreted protein expressed in liver, was down-regulated in hepatocellular carcinoma. Biochem Biophys Res Commun. 2007 Apr 13;355 (3):679-86

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)