United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

sPLA2-IIA Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Phospholipase A2 membrane associated, GIIC sPLA2, Group IIA phospholipase A2, Non-pancreatic secretory phospholipase A2, NPS-PLA2, Phosphatidylcholine 2-acylhydrolase 2A, PLA2G2A, PLA2B, PLA2L, RASF-A
  • Species:Human
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172054100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 140 AA. MW: 15.8 kDa (calculated). UniProtKB acc.no. P14555. N-Terminal His-tag, 16 extra AA.

Amino Acid Sequence

MRGSHHHHHHGMASHMNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12% SDS-PAGE separation of Human sPLA2-IIA
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 10μg/lane
3. non-reduced and non-heated sample, 10μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05M Acetate buffer pH4

Reconstitution

Add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Product References (4)

References

  • Jayaraman S, Fändrich M, Gursky O. Synergy between serum amyloid A and secretory phospholipase A(2). Elife. 2019 May 21;8:e46630. doi: 10.7554/eLife.46630. PubMed PMID: 31111824. PubMed CentralPMCID: PMC6557629. See more on PubMed
  • Lu S, Dong Z. Overexpression of secretory phospholipase A2-IIa supports cancer stem cell phenotype via HER/ERBB-elicited signaling in lung and prostate cancer cells. Int J Oncol. 2017 Jun;50(6):2113-2122. doi: 10.3892/ijo.2017.3964. Epub 2017 Apr 19. PubMed PMID: 28440478. See more on PubMed
  • Tanabe T, Shimokawaji T, Kanoh S, Rubin BK. Secretory phospholipases A2 are secreted from ciliated cells and increase mucin and eicosanoid secretion from goblet cells. Chest. 2015 Jun;147(6):1599-1609. doi: 10.1378/chest.14-0258. PubMed PMID: 25429648. PubMed CentralPMCID: PMC4451714. See more on PubMed
  • Rönkkö S, Rekonen P, Kaarniranta K, Puustjarvi T, Teräsvirta M, Uusitalo H. Phospholipase A2 in chamber angle of normal eyes and patients with primary open angle glaucoma and exfoliation glaucoma. Mol Vis. 2007 Mar 26;13:408-17. PubMed PMID: 17417602. PubMed CentralPMCID: PMC2642936. See more on PubMed
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít