Secretagogin Human, Sheep Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD184120100	0.1 mg	$277 / $243 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human Secretagogin.

Amino Acid Sequence

Recombinant Human Secretagogin, total 286 AA. MW: 33.3 kDa (calculated), N-terminal His-tag, 10 extra AA, The AA sequence is identical to UniProtKB/Swiss-Prot entry O76038.

MKHHHHHHASMDSSREPTLGRLDAAGFWQVWRRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Secretagogin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers, Oncology

Product References (3)

References

Atiskova Y, Bartsch S, Danyukova T, Becker E, Hagel C, Storch S, Bartsch U. Mice deficient in the lysosomal enzyme palmitoyl-protein thioesterase 1 (PPT1) display a complex retinal phenotype. Sci Rep. 2019 Oct 2;9(1):14185. doi: 10.1038/s41598-019-50726-8. PubMed PMID: 31578378. PubMed CentralPMCID: PMC6775149. See more on PubMed
Puthussery T, Gayet-Primo J, Taylor WR, Haverkamp S. Immunohistochemical identification and synaptic inputs to the diffuse bipolar cell type DB1 in macaque retina. J Comp Neurol. 2011 Dec 15;519(18):3640-56. doi: 10.1002/cne.22756. PubMed PMID: 22006647. PubMed CentralPMCID: PMC3500389. See more on PubMed
Koepsell T, Dugowson C, Voigt L, Bley L, Nelson JL, Daling J, Setterholm D, Stephens C, Ure C, Ballard J, et al.. Preliminary findings from a case-control study of the risk of rheumatoid arthritis in relation to oral contraceptive use. Br J Rheumatol. 1989;28 Suppl 1:41; discussion 42-5. doi: 10.1093/rheumatology/xxviii.suppl_1.41. PubMed PMID: 2819353. See more on PubMed

Summary References (8)

References to Secretagogin

Adolf K, Wagner L, Bergh A, Stattin P, Ottosen P, Borre M, Birkenkamp-Demtroder K, Orntoft TF, Torring N. Secretagogin is a new neuroendocrine marker in the human prostate. Prostate. 2007 Apr 1;67 (5):472-84
Gartner W, Lang W, Leutmetzer F, Domanovits H, Waldhausl W, Wagner L. Cerebral expression and serum detectability of secretagogin, a recently cloned EF-hand Ca(2+)-binding protein. Cereb Cortex. 2001 Dec;11 (12):1161-9
Gartner W, Vila G, Daneva T, Nabokikh A, Koc-Saral F, Ilhan A, Majdic O, Luger A, Wagner L. New functional aspects of the neuroendocrine marker secretagogin based on the characterization of its rat homolog. Am J Physiol Endocrinol Metab. 2007 Jul;293 (1):E347-54
Gartner W, Zierhut B, Mineva I, Sodeck G, Leutmezer F, Domanovits H, Prayer D, Wolf F, Base W, Weissel M, Wagner L. Brain natriuretic peptide correlates with the extent of atrial fibrillation-associated silent brain lesions. Clin Biochem. 2008 Dec;41 (18):1434-9
Lai M, Lu B, Xing X, Xu E, Ren G, Huang Q. Secretagogin, a novel neuroendocrine marker, has a distinct expression pattern from chromogranin A. Virchows Arch. 2006 Oct;449 (4):402-9
Pipp I, Wagner L, Rossler K, Budka H, Preusser M. Secretagogin expression in tumours of the human brain and its coverings. APMIS. 2007 Apr;115 (4):319-26
Rogstam A, Linse S, Lindqvist A, James P, Wagner L, Berggard T. Binding of calcium ions and SNAP-25 to the hexa EF-hand protein secretagogin. Biochem J. 2007 Jan 1;401 (1):353-63
Wagner L, Oliyarnyk O, Gartner W, Nowotny P, Groeger M, Kaserer K, Waldhausl W, Pasternack MS. Cloning and expression of secretagogin, a novel neuroendocrine- and pancreatic islet of Langerhans-specific Ca2+-binding protein. J Biol Chem. 2000 Aug 11;275 (32):24740-51

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)