United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

S100A8 Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein A8, Calgranulin-A, Migration inhibitory factor-related protein 8, MRP-8, p8, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Calprotectin L1L subunit, Urinary stone protein band A, S100A8, CAGA, CFAG, MRP8
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD184217100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Isotype

IgG

Preparation

The antibody was raised in sheep by immunization with the recombinant Human S100A8.

Amino Acid Sequence

Recombinant Human S100A8, total 103 AA. MW: 12.08 kDa (calculated). UniProtKB acc.no. P05109. N-Terminal His-tag, 10 extra AA.

MKHHHHHHASMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100A8.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology, Pulmonary diseases, Sepsis

Summary

S100A8 and S100A9 belong to a family of 25 homologous low-molecular-weight intracellular calcium-binding proteins that exhibit tissue and cell-specific expression. They are characterized by two distinct EF-hand (helix-loop-helix) calcium-binding domains connected by a hinge region. The N-terminal Ca2+ binding domain has lower affinity than the canonical C-terminal domain that allows for functionally important second messenger roles dependent on intracellular Ca2+ levels. Human S100A8 (also known as MRP8, calgranulin A, L1 light chain, cystic fibrosis antigen) is the most closely related member of the human (h) S100 family to mS100A8, although the level of homology is low (69% at the DNA level; 58% at the amino acid level). Human S100A8 is a calcium-binding protein member of the S100 protein family, is highly expressed in the cytosol of neutrophils and monocytes, and is frequently found at high levels in the extracellular milieu during inflammatory conditions. S100A8 is almost exclusively expressed by cells of myeloid lineage and is constitutively expressed in the cytosol of neutrophils. Monocytes and differentiated macrophages from inflamed tissues also express S100A8. Increased serum levels of the S100A8 (MRP-8) protein have been reported in inflammatory conditions including bacterial infection, arthritis, and cystic fibrosis (CF). Preferentially exists as a heterodimer or heterotetramer with S100A9 known as calprotectin (S100A8/A9). Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutrophils and monocytes but are absent in normal tissue macrophages and lymphocytes. Under chronic inflammatory conditions, such as psoriasis and malignant disorders, also expressed in the epidermis. Found in high concentrations at local sites of inflammation or in the serum of patients with inflammatory diseases such as rheumatoid, cystic fibrosis, inflammatory bowel disease, Crohn's disease, giant cell arteritis, cystic fibrosis, Sjogren's syndrome, systemic lupus erythematosus, and progressive systemic sclerosis. Involved in the formation and deposition of amyloids in the aging prostate known as corpora amylacea inclusions. Strongly up-regulated in many tumors, including gastric, esophageal, colon, pancreatic, bladder, ovarian, thyroid, breast and skin cancers.

Summary References (4)

References to S100A8

  • Chung TH, Oh JS, Lee YS, Kang KS, Jung JW, Youn HY, Hwang CY. Elevated serum levels of S100 calcium binding protein A8 (S100A8) reflect disease severity in canine atopic dermatitis. J Vet Med Sci. 2010 Jun;72 (6):693-700
  • Henke MO, Renner A, Rubin BK, Gyves JI, Lorenz E, Koo JS. Up-regulation of S100A8 and S100A9 protein in bronchial epithelial cells by lipopolysaccharide. Exp Lung Res. 2006 Sep;32 (8):331-47
  • Passey RJ, Xu K, Hume DA, Geczy CL. S100A8: emerging functions and regulation. J Leukoc Biol. 1999 Oct;66 (4):549-56
  • Srikrishna G. S100A8 and S100A9: new insights into their roles in malignancy. J Innate Immun. 2012;4 (1):31-40
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít