United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

S100A6 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein A6, Calcyclin, Prolactin receptor-associated protein, PRA, Growth factor-inducible protein 2A9, MLN 4, CACY
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181215100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human S100-A6.

Amino Acid Sequence

The immunization antigen (11.42 kDa) is a protein containing 100 AA of recombinant Human S100-A6 and N-Terminal His-tag 10 extra AA.

MKHHHHHHASMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100-A6.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Immune Response, Infection and Inflammation, Neural tissue markers, Oncology, Others

Summary References (9)

References to S100A6

  • Deloulme JC, Assard N, Mbele GO, Mangin C, Kuwano R, Baudier J. S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. J Biol Chem. 2000 Nov 10;275 (45):35302-10
  • Leclerc E, Fritz G, Weibel M, Heizmann CW, Galichet A. S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains. J Biol Chem. 2007 Oct 26;282 (43):31317-31
  • Lindsey JC, Lusher ME, Anderton JA, Gilbertson RJ, Ellison DW, Clifford SC. Epigenetic deregulation of multiple S100 gene family members by differential hypomethylation and hypermethylation events in medulloblastoma. Br J Cancer. 2007 Jul 16;97 (2):267-74
  • Nedjadi T, Kitteringham N, Campbell F, Jenkins RE, Park BK, Navarro P, Ashcroft F, Tepikin A, Neoptolemos JP, Costello E. S100A6 binds to annexin 2 in pancreatic cancer cells and promotes pancreatic cancer cell motility. Br J Cancer. 2009 Oct 6;101 (7):1145-54
  • Nowotny M, Spiechowicz M, Jastrzebska B, Filipek A, Kitagawa K, Kuznicki J. Calcium-regulated interaction of Sgt1 with S100A6 (calcyclin) and other S100 proteins. J Biol Chem. 2003 Jul 18;278 (29):26923-8
  • Shimamoto S, Takata M, Tokuda M, Oohira F, Tokumitsu H, Kobayashi R. Interactions of S100A2 and S100A6 with the tetratricopeptide repeat proteins, Hsp90/Hsp70-organizing protein and kinesin light chain. J Biol Chem. 2008 Oct 17;283 (42):28246-58
  • Tsoporis JN, Izhar S, Parker TG. Expression of S100A6 in cardiac myocytes limits apoptosis induced by tumor necrosis factor-alpha. J Biol Chem. 2008 Oct 31;283 (44):30174-83
  • van Dieck J, Fernandez-Fernandez MR, Veprintsev DB, Fersht AR. Modulation of the oligomerization state of p53 by differential binding of proteins of the S100 family to p53 monomers and tetramers. J Biol Chem. 2009 May 15;284 (20):13804-11
  • Wei BR, Hoover SB, Ross MM, Zhou W, Meani F, Edwards JB, Spehalski EI, Risinger JI, Alvord WG, Quinones OA, Belluco C, Martella L, Campagnutta E, Ravaggi A, Dai RM, Goldsmith PK, Woolard KD, Pecorelli S, Liotta LA, Petricoin EF, Simpson RM. Serum S100A6 concentration predicts peritoneal tumor burden in mice with epithelial ovarian cancer and is associated with advanced stage in patients. PLoS One. 2009;4 (10):e7670
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít