United States set
language
Menu Shopping cart $0 Search
Advanced Search
You are here:   Home Products and Services Antibodies S100A11 Human, Sheep Polyclonal Antibody
Manufactured by BioVendor

S100A11 Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein A11, Protein S100-C, Calgizzarin Metastatic lymph node gene 70 protein, MLN70, S100C
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs

RD184220100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human S100-A11.

Amino Acid Sequence

The immunization antigen (12.98 kDa) is a protein containing 115 AA of recombinant Human S100-A11. N-Terminal His-tag, 10 extra AA.

MKHHHHHHASMAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100-A11.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Cardiovascular disease, Immune Response, Infection and Inflammation, Oncology, Others

Summary

S100A11 (S100C; calgizzarin) was first isolated from chicken gizzard smooth muscle. Human homologue was later identified in human colorectal cancer cells and in colorectal normal mucosa, with much higher expression in the cancer cells. S100A11 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. The polypeptide chain consists of 105 amino acid residues giving molecular weight of unmodified monomeric protein 11.74 kDa. Disulphide bridge linking two monomers in the dimer via Cys-11 residues was found in its structure. The protein can be phosphorylated on some residues from which at least phosphorylation on Thr-10 causes significant structural changes. S100A11 binds to annexins A1 and A2, the DNA-dependent ATPase Rad54B, p53 and RAGE. It was proposed that up-regulated chondrocyte expression of S100A11 (as RAGE ligand) in OA cartilage and RAGE signaling through the p38 MAPK pathway promote inflammation-associated chondrocyte hypertrophy. RAGE signaling mediated by S100A11 thereby might have the potential to contribute to the progression of OA. S100A11 has also been shown to be secreted and to exert RAGE dependent signaling in human keratinocytes. S100A11 was found in many different human both normal and cancer tissues. S100A11 appears to play distinct roles depending on the tumour involved. In bladder carcinoma or renal carcinoma expression is related to tumour suppression however in prostate cancer, breast and pancreatic cancer S100A11 is thought to be a tumour promoter. S100A11 has been also indicated as one of potential biomarkers of infective endocarditis.

Summary References (13)

References to S100A11

  • Cecil DL, Johnson K, Rediske J, Lotz M, Schmidt AM, Terkeltaub R. Inflammation-induced chondrocyte hypertrophy is driven by receptor for advanced glycation end products. J Immunol. 2005 Dec 15;175 (12):8296-302
  • Cross SS, Hamdy FC, Deloulme JC, Rehman I. Expression of S100 proteins in normal human tissues and common cancers using tissue microarrays: S100A6, S100A8, S100A9 and S100A11 are all overexpressed in common cancers. Histopathology. 2005 Mar;46 (3):256-69
  • Kondo A, Sakaguchi M, Makino E, Namba M, Okada S, Huh NH. Localization of S100C immunoreactivity in various human tissues. Acta Med Okayama. 2002 Feb;56 (1):31-4
  • Kouno T, Mizuguchi M, Sakaguchi M, Makino E, Mori Y, Shinoda H, Aizawa T, Demura M, Huh NH, Kawano K. The structure of S100A11 fragment explains a local structural change induced by phosphorylation. J Pept Sci. 2008 Oct;14 (10):1129-38
  • Leclerc E, Fritz G, Vetter SW, Heizmann CW. Binding of S100 proteins to RAGE: an update. Biochim Biophys Acta. 2009 Jun;1793 (6):993-1007
  • Memon AA, Sorensen BS, Meldgaard P, Fokdal L, Thykjaer T, Nexo E. Down-regulation of S100C is associated with bladder cancer progression and poor survival. Clin Cancer Res. 2005 Jan 15;11 (2 Pt 1):606-11
  • Ohuchida K, Mizumoto K, Ohhashi S, Yamaguchi H, Konomi H, Nagai E, Yamaguchi K, Tsuneyoshi M, Tanaka M. S100A11, a putative tumor suppressor gene, is overexpressed in pancreatic carcinogenesis. Clin Cancer Res. 2006 Sep 15;12 (18):5417-22
  • Rehman I, Azzouzi AR, Cross SS, Deloulme JC, Catto JW, Wylde N, Larre S, Champigneuille J, Hamdy FC. Dysregulated expression of S100A11 (calgizzarin) in prostate cancer and precursor lesions. Hum Pathol. 2004 Nov;35 (11):1385-91
  • Rety S, Osterloh D, Arie JP, Tabaries S, Seeman J, Russo-Marie F, Gerke V, Lewit-Bentley A. Structural basis of the Ca(2+)-dependent association between S100C (S100A11) and its target, the N-terminal part of annexin I. Structure. 2000 Feb 15;8 (2):175-84
  • Sakaguchi M, Sonegawa H, Murata H, Kitazoe M, Futami J, Kataoka K, Yamada H, Huh NH. S100A11, an dual mediator for growth regulation of human keratinocytes. Mol Biol Cell. 2008 Jan;19 (1):78-85
  • Tanaka M, Adzuma K, Iwami M, Yoshimoto K, Monden Y, Itakura M. Human calgizzarin; one colorectal cancer-related gene selected by a large scale random cDNA sequencing and northern blot analysis. Cancer Lett. 1995 Mar 2;89 (2):195-200
  • Thuny F, Textoris J, Amara AB, Filali AE, Capo C, Habib G, Raoult D, Mege JL. The gene expression analysis of blood reveals S100A11 and AQP9 as potential biomarkers of infective endocarditis. PLoS One. 2012;7 (2):e31490
  • Todoroki H, Kobayashi R, Watanabe M, Minami H, Hidaka H. Purification, characterization, and partial sequence analysis of a newly identified EF-hand type 13-kDa Ca(2+)-binding protein from smooth muscle and non-muscle tissues. J Biol Chem. 1991 Oct 5;266 (28):18668-73
Related Products

By Research Topic

Cardiovascular disease
Immune Response, Infection and Inflammation
Oncology
Others

By Molecule

S100A11

By Technical Data

S100A11 - Antibodies
S100A11 - Polyclonal Antibody - Antibodies
Human - S100A11 - Antibodies
S100A11 - from Sheep - Antibodies
S100A11 - for Western blotting - Antibodies
S100A11 - for ELISA - Antibodies
S100A11 - for Immunohistochemistry - Antibodies
S100A11 - Antigene from E. coli - Antibodies
Polyclonal Antibody - Antibodies
Human - Polyclonal Antibody - Antibodies
Polyclonal Antibody - from Sheep - Antibodies
Polyclonal Antibody - for Western blotting - Antibodies
Polyclonal Antibody - for ELISA - Antibodies
Polyclonal Antibody - for Immunohistochemistry - Antibodies
Polyclonal Antibody - Antigene from E. coli - Antibodies
Human - Antibodies
Human - from Sheep - Antibodies
Human - for Western blotting - Antibodies
Human - for ELISA - Antibodies
Human - for Immunohistochemistry - Antibodies
Human - Antigene from E. coli - Antibodies
from Sheep - Antibodies
from Sheep - for Western blotting - Antibodies
from Sheep - for ELISA - Antibodies
from Sheep - for Immunohistochemistry - Antibodies
from Sheep - Antigene from E. coli - Antibodies
for Western blotting - Antibodies
for Western blotting - Antigene from E. coli - Antibodies
for ELISA - Antibodies
for ELISA - Antigene from E. coli - Antibodies
for Immunohistochemistry - Antibodies
for Immunohistochemistry - Antigene from E. coli - Antibodies
Antigene from E. coli - Antibodies

Docs
Print
Subscribe to Our Newsletter! Discover News from
BioVendor R&D Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D Subscribe Now
zavřít