United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Retinol Binding Protein 4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Plasma retinol-binding protein, PRBP, RBP, RBP4, PRO2222
  • Species:Human
Cat. No. Size Price


RD172104100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 211 AA. MW: 24.4 kDa (calculated). N-terminal His-Tag and TEV cleavage site, 28 extra AA.

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

Endotoxin

< 1.0 EU/μg

Formulation

Lyophilized in 1 mg-mL in PBS.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Storage/Expiration

Store lyophilized protein at -20 °C. Aliquot reconstituted protein and store at -80 °C. Avoid repeated freezing/thawing cycles.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Summary

Retinol binding protein (RBP) 4 is the only specific transport protein for vitamin A in the circulation whose function is to deliver vitamin to target tissues (1). In obesity and type 2 diabetes, expression of Glut4 is significantly impaired in adipocytes. Glucose transport via Glut4 is the rate-limiting step for glucose use by muscle and adipose tissue (2). Yang et al. noted that adipocyte-specific deletion of Gluts led to notable elevation of RBP4 causing systemic insulin resistance, and that reduction of RBP4 improved insulin resistance (3). This identified a novel role of RBP4 in regulating insulin action and RBP4 is recorded as an adipocyte-derived hormone. Thus, measurement of serum or plasma RBP4 is a useful means for understanding of metabolic disorders.

Summary References (3)

References to Retinol Binding Protein 4

  • Quadro L, Blaner WS, Salchow DJ, Vogel S, Piantedosi R, Gouras P, Freeman S, Cosma MP, Colantuoni V, Gottesman ME. Impaired retinal function and vitamin A availability in mice lacking retinol-binding protein. EMBO J. 1999 Sep 1;18 (17):4633-44
  • Shepherd PR, Kahn BB. Glucose transporters and insulin action--implications for insulin resistance and diabetes mellitus. N Engl J Med. 1999 Jul 22;341 (4):248-57
  • Yang Q, Graham TE, Mody N, Preitner F, Peroni OD, Zabolotny JM, Kotani K, Quadro L, Kahn BB. Serum retinol binding protein 4 contributes to insulin resistance in obesity and type 2 diabetes. Nature. 2005 Jul 21;436 (7049):356-62
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít
Privacy Settings

We, BioVendor Group, use cookies and personal data to ensure the functionality of the website and, with your consent, for personalizing the content of our web pages, among other things. Detailed information about cookies and the transfer of personal data based on consent can be found in the More Information section. You can adjust the scope of allowed cookies and granted consents in the Settings section.