United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Peptidoglycan Recognition Protein 1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:PGRP-S, PGLYRP1, TNFSF3L, SBBI68, UNQ639/PRO1269
  • Species:Human
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172316100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 185 AA. MW: 20.68 kDa (calculated). UniProtKB acc.no. O75594 (Gln22-Pro196). N-terminal His-tag (10 extra AA). Protein identity confirmed by MS.

Amino Acid Sequence

MKHHHHHHASQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human PGRP-1:
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and heated sample, 2.5 μg/lane
3. non-reduced and non-heated sample, 25 μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M Acetate buffer pH=4.0

Reconstitution

Add 200μl of 0.1M Acetate buffer pH=4.0 to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely at 37°C. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Immune Response, Infection and Inflammation

Summary

Peptidoglycan recognition protein 1 binds to peptidoglycan of bacteria and affects the peptidoglycan biosynthesis. It possesses bactericidal activity towards Gram-positive bacteria and bacteriostatic towards Gram-negative bacteria. Peptidoglycan recognition protein 1 plays a role in innate immunity.

Product References (1)

References

  • Alameh S, Bartolo G, O'Brien S, Henderson EA, Gonzalez LO, Hartmann S, Klimko CP, Shoe JL, Cote CK, Grill LK, Levitin A, Martchenko Shilman M. Anthrax toxin component, Protective Antigen, protects insects from bacterial infections. PLoS Pathog. 2020 Aug 31;16(8):e1008836. doi: 10.1371/journal.ppat.1008836. eCollection 2020 Aug. PubMed PMID: 32866212. PubMed CentralPMCID: PMC7458312. See more on PubMed
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít