United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Osteoprotegerin Human Pichia Pastoris

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Pichia Pastoris
  • Other names:OPG, Osteoclastogenesis inhibitory factor, OCIF, TNFRSF11B, Tumor Necrosis Factor Receptor Superfamily Member 11B
  • Species:Human
Cat. No. Size Price


RP1762660050 50 µg $250
RP1762661000 1 mg $1417,5
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Recombinant OPG produced in yeast contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22–201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant Osteoprotegrin migrates as a 49 kDa protein in SDS-PAGE under reducing conditions. The OPG is purified by proprietary chromatographic techniques.

Amino Acid Sequence

OPG22–201:ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL.Fc232:EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Source

Pichia Pastoris

Purity

Greater than 90.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Biological Activity

Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL (sRANKL).

Formulation

OPG was lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in PBS, pH= 7.4.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

It is recommended to reconstitute the lyophilized Osteoprotegerin in sterile 18 M?-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Physical Appearance

Sterile filtered white lyophilized (freeze-dried) powder.

Summary

Research topic

Bone and cartilage metabolism

Summary

Osteoprotegerin (OPG) or osteoclastogenesis inhibitory factor (OCIF) is a secretory glycoprotein belonging to TNF receptor superfamily. OPG consists of 401 amino acid residues, it has a molecular weight of 60 kDa as a monomer and 120 kDa as a disulfide-linked dimer and is produced in different tissues, e.g. bone, skin, liver, stomach, intestine and lung. Osteoprotegerin inhibits the recruitment, proliferation and activation of osteoclasts. Osteoclast formation activity may be monitored principally by determination of concentration ratio of osteoprotegerin ligand (OPGL)/OPG. Alteration of this ratio may be the cause of bone loss in many imbalances in bone metabolism such as osteoporosis, osteopetrosis, hypercalcemia, metastatic osteolytic lesions and rheumatic bone degradation.

Summary References (17)

References to Osteoprotegerin

  • Asanuma YF, Shimada Y, Kouzu N, Yokota K, Nakajima K, Sato K, Akiyama Y, Isozaki M, Mikami AS, Kobayashi H, Mimura T. Serum osteoprotegerin concentration is associated with carotid atherosclerotic plaque in patients with rheumatoid arthritis. Mod Rheumatol. 2012 May 15;
  • Aubin JE, Bonnelye E. Osteoprotegerin and its ligand: A new paradigm for regulation of osteoclastogenesis and bone resorption. Medscape Womens Health. 2000 Mar;5 (2):5
  • Avignon A, Sultan A, Piot C, Mariano-Goulart D, Thuan Dit Dieudonne JF, Cristol JP, Dupuy AM. Osteoprotegerin: a novel independent marker for silent myocardial ischemia in asymptomatic diabetic patients. Diabetes Care. 2007 Nov;30 (11):2934-9
  • Bai P, Sun Y, Jin J, Hou J, Li R, Zhang Q, Wang Y. Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis. Respir Res. 2011;12:157
  • Bucay N, Sarosi I, Dunstan CR, Morony S, Tarpley J, Capparelli C, Scully S, Tan HL, Xu W, Lacey DL, Boyle WJ, Simonet WS. osteoprotegerin-deficient mice develop early onset osteoporosis and arterial calcification. Genes Dev. 1998 May 1;12 (9):1260-8
  • Feuerherm AJ, Borset M, Seidel C, Sundan A, Leistad L, Ostensen M, Faxvaag A. Elevated levels of osteoprotegerin (OPG) and hepatocyte growth factor (HGF) in rheumatoid arthritis. Scand J Rheumatol. 2001;30 (4):229-34
  • Golledge J, McCann M, Mangan S, Lam A, Karan M. Osteoprotegerin and osteopontin are expressed at high concentrations within symptomatic carotid atherosclerosis. Stroke. 2004 Jul;35 (7):1636-41
  • Gurban CV, Mederle O. The OPG/RANKL system and zinc ions are promoters of bone remodeling by osteoblast proliferation in postmenopausal osteoporosis. Rom J Morphol Embryol. 2011;52 (3 Suppl):1113-9
  • Hofbauer LC. Osteoprotegerin ligand and osteoprotegerin: novel implications for osteoclast biology and bone metabolism. Eur J Endocrinol. 1999 Sep;141 (3):195-210
  • Kerschan-Schindl K, Mitterbauer M, Fureder W, Kudlacek S, Grampp S, Bieglmayer C, Fialka-Moser V, Pietschmann P, Kalhs P. Bone metabolism in patients more than five years after bone marrow transplantation. Bone Marrow Transplant. 2004 Sep;34 (6):491-6
  • Lien G, Ueland T, Godang K, Selvaag AM, Forre OT, Flato B. Serum levels of osteoprotegerin and receptor activator of nuclear factor -kappaB ligand in children with early juvenile idiopathic arthritis: a 2-year prospective controlled study. Pediatr Rheumatol Online J. 2010;8:30
  • Moran CS, McCann M, Karan M, Norman P, Ketheesan N, Golledge J. Association of osteoprotegerin with human abdominal aortic aneurysm progression. Circulation. 2005 Jun 14;111 (23):3119-25
  • Morse LR, Nguyen HP, Jain N, Williams S, Tun CG, Battaglino RA, Stashenko P, Garshick E. Age and motor score predict osteoprotegerin level in chronic spinal cord injury. J Musculoskelet Neuronal Inter. 2008 Jan-Mar;8 (1):50-7
  • Nellemann B, Gormsen LC, Dollerup J, Schmitz O, Mogensen CE, Rasmussen LM, Nielsen S. Simvastatin reduces plasma osteoprotegerin in type 2 diabetic patients with microalbuminuria. Diabetes Care. 2007 Dec;30 (12):3122-4
  • Roysland R, Bonaca MP, Omland T, Sabatine M, Murphy SA, Scirica BM, Bjerre M, Flyvbjerg A, Braunwald E, Morrow DA. Osteoprotegerin and cardiovascular mortality in patients with non-ST elevation acute coronary syndromes. Heart. 2012 May;98 (10):786-91
  • Secchiero P, Corallini F, Pandolfi A, Consoli A, Candido R, Fabris B, Celeghini C, Capitani S, Zauli G. An increased osteoprotegerin serum release characterizes the early onset of diabetes mellitus and may contribute to endothelial cell dysfunction. Am J Pathol. 2006 Dec;169 (6):2236-44
  • Simonet WS, Lacey DL, Dunstan CR, Kelley M, Chang MS, Luthy R, Nguyen HQ, Wooden S, Bennett L, Boone T, Shimamoto G, DeRose M, Elliott R, Colombero A, Tan HL, Trail G, Sullivan J, Davy E, Bucay N, Renshaw-Gegg L, Hughes TM, Hill D, Pattison W, Campbell P, Sander S, Van G, Tarpley J, Derby P, Lee R, Boyle WJ. Osteoprotegerin: a novel secreted protein i
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít