Type
Polyclonal Antibody
Applications
Western blotting, Immunohistochemistry
Antibodies Applications
Source of Antigen
E. coli
Hosts
Sheep
Preparation
The antibody was raised in sheep by immunization with the recombinant Human Omentin.
Amino Acid Sequence
Total 294 AA. MW: 32.7 kDa (calculated). N-terminal His-tag, 14 extra AA. The AA sequence is identical to UniProtKB/Swiss-Prot entry Q8WWA0 (AA19–298).
MRGSHHHHHHGMASTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Species Reactivity
Human. Not yet tested in other species.
Purification Method
Immunoaffinity chromatography on a column with immobilized recombinant Human Omentin.
Antibody Content
0.1 mg (determined by BCA method, BSA was used as a standard)
Formulation
The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.
Reconstitution
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
Quality Control Test
Indirect ELISA – to determine titer of the antibody
SDS PAGE – to determine purity of the antibody
BCA - to determine quantity of the antibody
Note
This product is for research use only.
Research topic
Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Reproduction
Summary
Omentin (intelectin-1, intestinal lactoferin receptor, endothelian lectin HL-1, galactofuranosebinding lectin) is newly identified secretory protein that is highly and selectively expressed in visceral adipose tissue relative to subcutaneous adipose tissue (adipokine). The mature omentin is secretory glycoprotein consisting of 295 amino acids and 1-linked oligosacharides, and its basic structural unit is a 120-kDa homotrimer in which 40-kDa polipeptides are bridged by disulfide bonds. Omentin has been identified in other tissue at lower expression levels such are Paneth cells, endothelial cells, and visceral adipose stromal-vascular cells. A homolog of omentin has been identified that shares 83% amino acid identity with omentin and was referred to as omentin 2. The two omentin genes, omentin 1 and omentin 2, are localized adjacent to each other in chromosomal region, which has been previously linked to type 2 diabetes in several populations. To determine the impact of obesity-dependent insulin resistance on the regulation of two omentin isoforms, gene expression and plasma levels were measured in lean, overweight, and obese subjects. Omentin-1 was shown to be the major circulating isoform in human plasma. Lean subjects had significantly higher omentin-1 plasma levels than obese and overweight subjects. In addition, higher plasma omentin-1 levels were detected in women compared with men. Plasma omentin-1 levels were inversely correlated with BMI, waist circumference, leptin levels, and insulin resistance as measured by homeostasis model assessment and positively correlated with adiponectin and HDL levels. In summary, decreased omentin-1 levels are associated with increasing obesity and insulin resistance. An independent experiment reported that the addition of recombinant omentin-1 in vitro did not affect basal glucose uptake but did enhance insulin-stimulated glucose uptake in both subcutaneous and omental human adipocytes. Omentin-1 increased Akt phosphorylation in the absence and presence of insulin and may regulate insulin action. A recent study of women with the polycystic ovary syndrome (PCOS) found significantly reduced omentin-1 mRNA expression and protein levels in adipose tissue in overweight PCOS women. In addition, significantly lower plasma omentin-1 levels were detected in these women.
