United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

NT-proBNP Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:N-terminal Prohormone of Brain Natriuretic Peptide
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


New RD184486100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Source of Antigen

E. coli

Hosts

Sheep

Isotype

IgG

Preparation

The antibody was raised in sheep by immunization with the recombinant Human NT-proBNP.

Amino Acid Sequence

Recombinant Human NT-proBNP, total 83 AA. MW: 9.4 kDa (calculated). UniProtKB acc. no. P16860 (His27–Arg102). N-terminal His-tag (7 extra AA).

MKHHHHHHPLSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human NT-proBNP.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Cardiovascular disease, Diabetology - Other Relevant Products, Renal disease

Summary References (2)

References to NT-proBNP

  • Atisha D, Bhalla MA, Morrison LK, Felicio L, Clopton P, Gardetto N, Kazanegra R, Chiu A, Maisel AS. A prospective study in search of an optimal B-natriuretic peptide level to screen patients for cardiac dysfunction. Am Heart J. 2004 Sep;148 (3):518-23
  • Bhalla V, Willis S, Maisel AS. B-type natriuretic peptide: the level and the drug--partners in the diagnosis of congestive heart failure. Congest Heart Fail. 2004 Jan-Feb;10 (1 Suppl 1):3-27
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít