NT-proANP Human, Sheep Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
New RD184485100	0.1 mg	$277 / $243 / On request

Technical Data

Type

Polyclonal Antibody

Applications

ELISA

Source of Antigen

E. coli

Hosts

Sheep

Isotype

IgG

Preparation

The antibody was raised in sheep by immunization with the recombinant Human NT-proANP.

Amino Acid Sequence

Recombinant Human NT-proANP, total 106 AA. MW: 11.7 kDa (calculated). UniProtKB acc. No. P01160 (Asn26–Arg123). N-terminal His-tag, 8 extra AA.

MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human NT-proANP.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Cardiovascular disease, Sepsis

Summary

NT-pro ANP (N-terminal proatrial natriuretic peptide) means N-terminal polypeptide of ANP (atrial natriuretic peptide) precursor. In rough microsome of atrial cells prepro ANP with 149 amino acid residues is first produced, and its signal peptide (23 amino acids) is cut off in Golgi apparatus leaving pro ANP of 126 amino acids, which is stored in secretory granules. Before secretion, N-terminal peptide of 98 amino acids (NT-pro ANP) and C-terminal peptide of 28 amino acids (ANP) are separated. ANP is secreted from the atrium with the stimulation of atrial expansion owing to the increased blood volume and/or increase in intra-atrial pressure. ANP is a ring-shaped peptide, the main targets of which are kidney and blood vessels, and causes potent natriuresis, blood vessel expansion, to lower blood pressure. ANP forms natriuretic peptide family with BNP (B-type Natriuretic peptide) and CNP (C-type Natriuretic peptide). Plasma ANP very rapidly disappears owing to binding with its receptor and so-called clearance receptor (half-life about 100seconds in canine), making its exact measurement difficult. On the other hand, NT-pro ANP, because it does not bind clearance receptor, has a long half life (60–120mins in man), and serves as an excellent marker of ANP secretion. The measurement of NT-pro ANP is expected to be useful in the examination of heart diseases in dogs

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)