United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Neuroglobin Human E. coli Tag free

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:NGB
  • Species:Human
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172043100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 151 AA. MW: 17 kDa (calculated). UniProtKB acc.no. Q9NPG2. 150 AA of recombinant human Neuroglobin and one extra AA, N-terminal methionin.

Amino Acid Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12% SDS-PAGE separation of Human Neuroglobin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Neural tissue markers

Summary

Neuroglobin, 151 amino acid reside protein, mainly expressed in vertebrate brain and retina, is a recently identified member of the globin superfamily. Augmenting O(2) supply, neuroglobin promotes survival of neurons upon hypoxic injury, potentially limiting brain damage. Moreover, neuroglobin may be a novel oxidative stress-responsive sensor for signal transduction in the brain. Neuroglobin expression is increased by neuronal hypoxia in vitro and focal cerebral ischemia in vivo, and neuronal survival after hypoxia is reduced by inhibiting neuroglobin expression with an antisense oligodeoxynucle­otide and enhanced by neuroglobin overexpression

Product References (3)

References

  • Ostojić J, Grozdanić SD, Syed NA, Hargrove MS, Trent JT 3rd, Kuehn MH, Kwon YH, Kardon RH, Sakaguchi DS. Patterns of distribution of oxygen-binding globins, neuroglobin and cytoglobin in human retina. Arch Ophthalmol. 2008 Nov;126(11):1530-6. doi: 10.1001/archopht.126.11.1530. PubMed PMID: 19001220. See more on PubMed
  • Ostojic J, Grozdanic S, Syed NA, Hargrove MS, Trent JT 3rd, Kuehn MH, Kardon RH, Kwon YH, Sakaguchi DS. Neuroglobin and cytoglobin distribution in the anterior eye segment: a comparative immunohistochemical study. J Histochem Cytochem. 2008 Sep;56(9):863-72. doi: 10.1369/jhc.2008.951392. Epub 2008 Jun 23. PubMed PMID: 18574250. PubMed CentralPMCID: PMC2516955. See more on PubMed
  • Ostojić J, Sakaguchi DS, de Lathouder Y, Hargrove MS, Trent JT 3rd, Kwon YH, Kardon RH, Kuehn MH, Betts DM, Grozdanić S. Neuroglobin and cytoglobin: oxygen-binding proteins in retinal neurons. Invest Ophthalmol Vis Sci. 2006 Mar;47(3):1016-23. doi: 10.1167/iovs.05-0465. PubMed PMID: 16505036. See more on PubMed
Summary References (5)

References to Neuroglobin

  • Garry DJ, Mammen PP. Neuroprotection and the role of neuroglobin. Lancet. 2003 Aug 2;362 (9381):342-3
  • Mammen PP, Shelton JM, Goetsch SC, Williams SC, Richardson JA, Garry MG, Garry DJ. Neuroglobin, a novel member of the globin family, is expressed in focal regions of the brain. J Histochem Cytochem. 2002 Dec;50 (12):1591-8
  • Pesce A, Dewilde S, Nardini M, Moens L, Ascenzi P, Hankeln T, Burmester T, Bolognesi M. Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity. Structure. 2003 Sep;11 (9):1087-95
  • Sun Y, Jin K, Mao XO, Zhu Y, Greenberg DA. Neuroglobin is up-regulated by and protects neurons from hypoxic-ischemic injury. Proc Natl Acad Sci U S A. 2001 Dec 18;98 (26):15306-11
  • Sun Y, Jin K, Peel A, Mao XO, Xie L, Greenberg DA. Neuroglobin protects the brain from experimental stroke in vivo. Proc Natl Acad Sci U S A. 2003 Mar 18;100 (6):3497-500
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít