Interleukin-6 Human E. coli

Cat. No.	Size	Price 1 - 4 pcs / 5 - 9 pcs / 10+ pcs
RD172015100	0.1 mg	$421 / $370 / On request

Technical Data

Type

Recombinant protein

Description

Total 193 AA. MW: 22.05 kDa (calculated). UniProtKB acc.no. P05231. N-Terminal His-tag, 10 extra AA.

Amino Acid Sequence

MKHHHHHHASVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human Interleukin-6
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Cytokines and chemokines and related molecules, Energy metabolism and body weight regulation, Sepsis, COVID-19

Summary

Interleukin-6 is a multi-functional cytokine that regulates immune responses, acute phase reactions and hematopoiesis, and it may play a central role in host defense mechanisms. IL-6 is usually not produced constitutively by normal cells, but its expression is readily induced by a variety of cytokines, lipopolysaccharide or viral infections.

Summary References (7)

References to Interleukin-6

Cayphas S, Van Damme J, Vink A, Simpson RJ, Billiau A, Van Snick J. Identification of an interleukin HP1-like plasmacytoma growth factor produced by L cells in response to viral infection. J Immunol. 1987 Nov 1;139 (9):2965-9
Hirano T, Akira S, Taga T, Kishimoto T. Biological and clinical aspects of interleukin 6. Immunol Today. 1990 Dec;11 (12):443-9
Hirano T, Kishimoto T. Interleukin-6.Handbook of experimental pharmacology, Peptide Growth Factors and Their Receptors. Springer-Verlag. 1990;:633-665
Hirano T, Taga T, Nakano N, Yasukawa K, Kashiwamura S, Shimizu K, Nakajima K, Pyun KH, Kishimoto T. Purification to homogeneity and characterization of human B-cell differentiation factor (BCDF or BSFp-2). Proc Natl Acad Sci U S A. 1985 Aug;82 (16):5490-4
Koj A. The Role of Interleukin-6 as the Hepatocyte Stimulating Factor in the Network of Inflammatory Cytokines. Annals of the New York Academy. (1989);:557: 1–8
Nordan RP, Potter M. A macrophage-derived factor required by plasmacytomas for survival and proliferation in vitro. Science. 1986 Aug 1;233 (4763):566-9
Ray A, Tatter SB, Santhanam U, Helfgott DC, May LT, Sehgal PB. Regulation of expression of interleukin-6. Molecular and clinical studies. Ann N Y Acad Sci. 1989;557:353-61; discussion 361-2

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)