Hepatitis B Protein X (HBx) Virus Human, Rabbit Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD981038100	0.05 mg	$300 / $266 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, Immunoprecipitation

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant HBx.

Amino Acid Sequence

The immunization antigen (17 kDa) is a protein containing 153 AA of recombinant HBx and one extra AA, N-terminal methionin.

MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA

Species Reactivity

Human

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Hepatitis B Protein X.

Antibody Content

0.05 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.05 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Others

Summary

Hepatitis B virus X protein (HBx) is a 17 kD transcriptional coactivator that plays a significant role in the regulation of genes involved in inflammation and cell survival. It regulates many transcription factors including nuclear factor kappa B (NF-kappaB) and plays a key role in hepatocarcinogenesis. HBx facilitates the binding of cAMP response element binding protein (CREB) to its responsive element. HBx stabilizes the cellular coactivator ASC-2 through direct protein-protein interaction, affecting the regulation of genes actively transcribed in liver cancer cells. HBx transactivates both JNK and MAPK signal transduction pathways in association with the mobilization of cytosolic Ca²⁺. The communication between HBx and general transcription factor TFIIB is also one of the mechanisms which account for its transcriptional transactivation. HBx decreased the expression of PTEN a known tumor suppressor and a negative regulator of phosphatidylinositol 3'-kinase/AKT and HBx decreased the expression of PTEN in HBx-transfected cells. The etiology of hepatocellular carcinoma (HCC) is involved with hepatitis B virus (HBV) infection and HBx in particular plays a role in the development of HBV-related HCC. The persistence of HBx is important to the pathogenesis of early HCC and HBx expression in the liver during chronic HBV infection may be an important prognostic marker for the development of HCC.

Product References (4)

References

Hagiwara S, Nishida N, Park AM, Komeda Y, Sakurai T, Watanabe T, Kudo M. Contribution of C1485T mutation in the HBx gene to human and murine hepatocarcinogenesis. Sci Rep. 2017 Sep 5;7(1):10440. doi: 10.1038/s41598-017-10570-0. PubMed PMID: 28874700. PubMed CentralPMCID: PMC5585302. See more on PubMed
Lee AR, Lim KH, Park ES, Kim DH, Park YK, Park S, Kim DS, Shin GC, Kang HS, Won J, Sim H, Ha YN, Jae B, Choi SI, Kim KH. Multiple Functions of Cellular FLIP Are Essential for Replication of Hepatitis B Virus. J Virol. 2018 Jul 31;92(16):e00339-18. doi: 10.1128/JVI.00339-18. Print 2018 Aug 15. PubMed PMID: 29875248. PubMed CentralPMCID: PMC6069189. See more on PubMed
Shin GC, Kang HS, Lee AR, Kim KH. Hepatitis B virus-triggered autophagy targets TNFRSF10B/death receptor 5 for degradation to limit TNFSF10/TRAIL response. Autophagy. 2016 Dec;12(12):2451-2466. doi: 10.1080/15548627.2016.1239002. Epub 2016 Oct 14. PubMed PMID: 27740879. PubMed CentralPMCID: PMC5173271. See more on PubMed
Kim W, Lee S, Son Y, Ko C, Ryu WS. DDB1 Stimulates Viral Transcription of Hepatitis B Virus via HBx-Independent Mechanisms. J Virol. 2016 Oct 14;90(21):9644-9653. doi: 10.1128/JVI.00977-16. Print 2016 Nov 1. PubMed PMID: 27535046. PubMed CentralPMCID: PMC5068517. See more on PubMed

Summary References (5)

References to Hepatitis B Virus Protein X

Arbuthnot P, Kew M. Hepatitis B virus and hepatocellular carcinoma. Int J Exp Pathol. 2001 Apr; 82(2): 77-100. Review.
Hwang GY, Lin CY, Huang LM, Wang YH, Wang JC, Hsu CT, Yang SS, Wu CC. Detection of the hepatitis B virus X protein (HBx) antigen and anti-HBx antibodies in cases of human hepatocellular carcinoma. J Clin Microbiol. 2003 Dec; 41(12): 5598-603.
Madden CR, Slagle BL. Stimulation of cellular proliferation by hepatitis B virus X protein. Dis Markers. 2001; 17(3): 153-7. Review.
Song CZ, Bai ZL, Song CC, Wang QW. Aggregate formation of hepatitis B virus X protein affects cell cycle and apoptosis. World J Gastroenterol. 2003 Jul; 9(7): 1521-4.
Tralhao JG, Roudier J, Morosan S, Giannini C, Tu H, Goulenok C, Carnot F, Zavala F, Joulin V, Kremsdorf D, Brechot C. Paracrine in vivo inhibitory effects of hepatitis B virus X protein (HBx) on liver cell proliferation: an alternative mechanism of HBx-related pathogenesis. Proc Natl Acad Sci U S A. 2002 May 14; 99(10): 6991-6.

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)