Epidermal Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD181060100	0.1 mg	$300 / $266 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human FABP5.

Amino Acid Sequence

The immunization antigen (15.2 kDa) is a protein containing 135 AA of recombinant Human FABP5 and one extra AA, N-terminal methionin.

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human FABP5.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Summary

Research topic

Cardiovascular disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Oncology

Summary

Human fatty acid binding protein EFABP is a 15 kD member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to bind fatty acids and related compounds ( bile acids or retinoids). in an internal cavity. The fatty acid binding proteins aP2 (fatty acid binding protein [FABP]-4) and mal1 (EFABP) are closely related and both are expressed in adipocytes. Absence of EFABP/mal1 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Adipocytes isolated from mal1-deficient mice also exhibited enhanced insulin-stimulated glucose transport capacity. In contrast, mice expressing high levels of mal1 in adipose tissue display reduced systemic insulin sensitivity .

Product References (8)

References

Carbonetti G, Wilpshaar T, Kroonen J, Studholme K, Converso C, d'Oelsnitz S, Kaczocha M. FABP5 coordinates lipid signaling that promotes prostate cancer metastasis. Sci Rep. 2019 Dec 12;9(1):18944. doi: 10.1038/s41598-019-55418-x. PubMed PMID: 31831821. PubMed CentralPMCID: PMC6908725. See more on PubMed
Bogdan D, Falcone J, Kanjiya MP, Park SH, Carbonetti G, Studholme K, Gomez M, Lu Y, Elmes MW, Smietalo N, Yan S, Ojima I, Puopolo M, Kaczocha M. Fatty acid-binding protein 5 controls microsomal prostaglandin E synthase 1 (mPGES-1) induction during inflammation. J Biol Chem. 2018 Apr 6;293(14):5295-5306. doi: 10.1074/jbc.RA118.001593. Epub 2018 Feb 13. PubMed PMID: 29440395. PubMed CentralPMCID: PMC5892576. See more on PubMed
Peng X, Studholme K, Kanjiya MP, Luk J, Bogdan D, Elmes MW, Carbonetti G, Tong S, Gary Teng YH, Rizzo RC, Li H, Deutsch DG, Ojima I, Rebecchi MJ, Puopolo M, Kaczocha M. Fatty-acid-binding protein inhibition produces analgesic effects through peripheral and central mechanisms. Mol Pain. 2017 Jan;13:1744806917697007. doi: 10.1177/1744806917697007. PubMed PMID: 28326944. PubMed CentralPMCID: PMC5407663. See more on PubMed
Martin GG, Chung S, Landrock D, Landrock KK, Dangott LJ, Peng X, Kaczocha M, Murphy EJ, Kier AB, Schroeder F. Female Mice are Resistant to Fabp1 Gene Ablation-Induced Alterations in Brain Endocannabinoid Levels. Lipids. 2016 Sep;51(9):1007-20. doi: 10.1007/s11745-016-4175-4. Epub 2016 Jul 23. PubMed PMID: 27450559. PubMed CentralPMCID: PMC5418128. See more on PubMed
Martin GG, Chung S, Landrock D, Landrock KK, Huang H, Dangott LJ, Peng X, Kaczocha M, Seeger DR, Murphy EJ, Golovko MY, Kier AB, Schroeder F. FABP-1 gene ablation impacts brain endocannabinoid system in male mice. J Neurochem. 2016 Aug;138(3):407-22. doi: 10.1111/jnc.13664. Epub 2016 Jun 22. PubMed PMID: 27167970. PubMed CentralPMCID: PMC4961623. See more on PubMed
Yao PL, Morales JL, Zhu B, Kang BH, Gonzalez FJ, Peters JM. Activation of peroxisome proliferator-activated receptor-β/δ (PPAR-β/δ) inhibits human breast cancer cell line tumorigenicity. Mol Cancer Ther. 2014 Apr;13(4):1008-17. doi: 10.1158/1535-7163.MCT-13-0836. Epub 2014 Jan 24. PubMed PMID: 24464939. PubMed CentralPMCID: PMC3981956. See more on PubMed
Borland MG, Khozoie C, Albrecht PP, Zhu B, Lee C, Lahoti TS, Gonzalez FJ, Peters JM. Stable over-expression of PPARβ/δ and PPARγ to examine receptor signaling in human HaCaT keratinocytes. Cell Signal. 2011 Dec;23(12):2039-50. doi: 10.1016/j.cellsig.2011.07.020. Epub 2011 Aug 4. PubMed PMID: 21843636. PubMed CentralPMCID: PMC3184348. See more on PubMed
Yamane Y, Moriyama K, Yasuda C, Miyata S, Aihara M, Ikezawa Z, Miyazaki K. New horny layer marker proteins for evaluating skin condition in atopic dermatitis. Int Arch Allergy Immunol. 2009;150(1):89-101. doi: 10.1159/000210385. Epub 2009 Apr 2. PubMed PMID: 19339807. See more on PubMed

Summary References (7)

References to Epidermal Fatty Acid Binding Protein

Fisher RM, Eriksson P, Hoffstedt J, Hotamisligil GS, Thorne A, Ryden M, Hamsten A, Arner P. Fatty acid binding protein expression in different adipose tissue depots from lean and obese individuals. Diabetologia. 2001 Oct;44 (10):1268-73
Fisher RM, Hoffstedt J, Hotamisligil GS, Thorne A, Ryden M. Effects of obesity and weight loss on the expression of proteins involved in fatty acid metabolism in human adipose tissue. Int J Obes Relat Metab Disord. 2002 Oct;26 (10):1379-85
Haunerland NH, Spener F. Fatty acid-binding proteins--insights from genetic manipulations. Prog Lipid Res. 2004 Jul;43 (4):328-49
Hertzel AV, Bennaars-Eiden A, Bernlohr DA. Increased lipolysis in transgenic animals overexpressing the epithelial fatty acid binding protein in adipose cells. J Lipid Res. 2002 Dec;43 (12):2105-11
Jenkins-Kruchten AE, Bennaars-Eiden A, Ross JR, Shen WJ, Kraemer FB, Bernlohr DA. Fatty acid-binding protein-hormone-sensitive lipase interaction. Fatty acid dependence on binding. J Biol Chem. 2003 Nov 28;278 (48):47636-43
Maeda K, Cao H, Kono K, Gorgun CZ, Furuhashi M, Uysal KT, Cao Q, Atsumi G, Malone H, Krishnan B, Minokoshi Y, Kahn BB, Parker RA, Hotamisligil GS. Adipocyte/macrophage fatty acid binding proteins control integrated metabolic responses in obesity and diabetes. Cell Metab. 2005 Feb;1 (2):107-19
Makowski L, Hotamisligil GS. The role of fatty acid binding proteins in metabolic syndrome and atherosclerosis. Curr Opin Lipidol. 2005 Oct;16 (5):543-8

By Research Topic

Cardiovascular disease
Diabetology - Other Relevant Products
Energy metabolism and body weight regulation
Oncology

By Molecule

Epidermal Fatty Acid Binding Protein

By Technical Data

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)