United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Cystatin C Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Post G-globulin, Cystatin-3, Neuroendocrine basic polypeptide, Gamma-trace, Post-gamma-globulin, CST3
  • Species:Rat
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD372009100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 134 AA, Mw: 14.93 kDa (calculated). UniProtKB acc.no. P14841. N-terminal His-tag, 14 extra AA.

Amino Acid Sequence

MRGSHHHHHHGMASGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Rat Cystatin C
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Neural tissue markers, Renal disease, Animal studies

Summary

Cystatin C is a non-glycosilated basic single-chain protein consisting of 120 amino acids with a molecular weight of 13.36 kDa and is characterized by two disulfide bonds in the carboxy-terminal region. It belongs to the cystatins superfamilly which inactivates lysosomal cysteine proteinases, e.g. cathepsin B, H,.K, L and S. Imbalance between Cystatin C and cysteine proteinases is associated with inflammation, renal failure, cancer, Alzheimer's di­sease, multiple sclerosis and hereditary Cystatin C amyloid angiopathy. Its increased level has been found in patients with autoimune diseases, with colorectal tumors and in patients on dyalisis. Serum Cystatin C seems to be better marker of glomerular filtration rate than creatinine. On the other hand, low concentration of Cystatin C presents a risk factor for secondary cardiovascular events.

Summary References (20)

References to Cystatin C

  • Bokenkamp A, Domanetzki M, Zinck R, Schumann G, Byrd D, Brodehl J. Cystatin C--a new marker of glomerular filtration rate in children independent of age and height. Pediatrics. 1998 May;101 (5):875-81
  • Delanaye P, Cavalier E, Krzesinski JM. Cystatin C, renal function, and cardiovascular risk. Ann Intern Med. 2008 Feb 19;148 (4):323
  • Deng A, Irizarry MC, Nitsch RM, Growdon JH, Rebeck GW. Elevation of cystatin C in susceptible neurons in Alzheimer's disease. Am J Pathol. 2001 Sep;159 (3):1061-8
  • Dharnidharka VR, Kwon C, Stevens G. Serum cystatin C is superior to serum creatinine as a marker of kidney function: a meta-analysis. Am J Kidney Dis. 2002 Aug;40 (2):221-6
  • Ekiel I, Abrahamson M, Fulton DB, Lindahl P, Storer AC, Levadoux W, Lafrance M, Labelle S, Pomerleau Y, Groleau D, LeSauteur L, Gehring K. NMR structural studies of human cystatin C dimers and monomers. J Mol Biol. 1997 Aug 15;271 (2):266-77
  • Luc G, Bard JM, Lesueur C, Arveiler D, Evans A, Amouyel P, Ferrieres J, Juhan-Vague I, Fruchart JC, Ducimetiere P. Plasma cystatin-C and development of coronary heart disease: The PRIME Study. Atherosclerosis. 2006 Apr;185 (2):375-80
  • Macisaac RJ, Tsalamandris C, Thomas MC, Premaratne E, Panagiotopoulos S, Smith TJ, Poon A, Jenkins MA, Ratnaike SI, Power DA, Jerums G. Estimating glomerular filtration rate in diabetes: a comparison of cystatin-C- and creatinine-based methods. Diabetologia. 2006 Jul;49 (7):1686-9
  • Mojiminiyi OA, Abdella N. Evaluation of cystatin C and beta-2 microglobulin as markers of renal function in patients with type 2 diabetes mellitus. J Diabetes Complications. 2003 May-Jun;17 (3):160-8
  • Moran A, Katz R, Smith NL, Fried LF, Sarnak MJ, Seliger SL, Psaty B, Siscovick DS, Gottdiener JS, Shlipak MG. Cystatin C concentration as a predictor of systolic and diastolic heart failure. J Card Fail. 2008 Feb;14 (1):19-26
  • Muntner P, Mann D, Winston J, Bansilal S, Farkouh ME. Serum cystatin C and increased coronary heart disease prevalence in US adults without chronic kidney disease. Am J Cardiol. 2008 Jul 1;102 (1):54-7
  • Muntner P, Winston J, Uribarri J, Mann D, Fox CS. Overweight, obesity, and elevated serum cystatin C levels in adults in the United States. Am J Med. 2008 Apr;121 (4):341-8
  • Mussap M, Plebani M. Biochemistry and clinical role of human cystatin C. Crit Rev Clin Lab Sci. 2004;41 (5-6):467-550
  • Nakashima I, Fujinoki M, Fujihara K, Kawamura T, Nishimura T, Nakamura M, Itoyama Y. Alteration of cystatin C in the cerebrospinal fluid of multiple sclerosis. Ann Neurol. 2007 Aug;62 (2):197-200; discussion 205
  • Ortiz F, Harmoinen A, Paavonen T, Koskinen P, Gronhagen-Riska C, Honkanen E. Is Cystatin C more sensitive than creatinine in detecting early chronic allograft nephropathy?. Clin Nephrol. 2008 Jul;70 (1):18-25
  • Parikh NI, Hwang SJ, Yang Q, Larson MG, Guo CY, Robins SJ, Sutherland P, Benjamin EJ, Levy D, Fox CS. Clinical correlates and heritability of cystatin C (from the Framingham Offspring Study). Am J Cardiol. 2008 Nov 1;102 (9):1194-8
  • Perlemoine C, Beauvieux MC, Rigalleau V, Baillet L, Barthes N, Derache P, Gin H. Interest of cystatin C in screening diabetic patients for early impairment of renal function. Metabolism. 2003 Oct;52 (10):1258-64
  • Premaratne E, MacIsaac RJ, Finch S, Panagiotopoulos S, Ekinci E, Jerums G. Serial measurements of cystatin C are more accurate than creatinine-based methods in detecting declining renal function in type 1 diabetes. Diabetes Care. 2008 May;31 (5):971-3
  • Risch L, Blumberg A, Huber A. Rapid and accurate assessment of glomerular filtration rate in patients with renal transplants using serum cystatin C. Nephrol Dial Transplant. 1999 Aug;14 (8):1991-6
  • Samouilidou EC, Grapsa E. Relationship of serum cystatin C with C-reactive protein and apolipoprotein A1 in patients on hemodialysis. Ren Fail. 2008;30 (7):711-5
  • Servais A, Giral P, Bernard M, Bruckert E, Deray G, Isnard Bagnis C. Is serum cystatin-C a reliable marker for metaboli
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít