United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Clusterin Rat, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Apolipoprotein J, Apo J, Aging-associated gene 4 protein, AAG4, Complement cytolysis inhibitor, CLI, Complement-associated protein SP-40,40, Ku70-binding protein 1, NA1/NA2, Sulfated glycoprotein 2, SGP-2, Testosterone-repressed prostate message 2, TRPM-2
  • Species:Rat
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD381034100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Isotype

IgG

Preparation

The antibody was raised in rabbits by immunization with the recombinant Rat Clusterin.

Amino Acid Sequence

Recombinant Rat Clusterin, total 240 AA. MW: 26.5 kDa (calculated). UniProtKB acc.no. P05371. N-Terminal T7-Tag and C-Terminal His-tag, 25 extra AA.

MASMTGGQQMGRDPNSSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHLLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQALEHHHHHH

Species Reactivity

Rat. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Rat Clusterin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

We advise you to centrifuge this product vial before use. Add 0.2 ml of deionized water, mix gently and let the lyophilized pellet dissolve completely (at least 15 minutes with occasionally gently shaking, not to foam). Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Neural tissue markers, Oncology, Others, Renal disease, Sepsis, Animal studies

Summary

Clusterin is a 75–80 kD disulfide-linked heterodimeric protein containing about 30% of N-linked carbohydrate rich in sialic acid, but truncated forms targeted to the nucleus have also been identified.

The precursor polypeptide chain is cleaved proteolytically to remove the 22-mer secretory signal peptide and subsequently between residues 227/228 to generate the alpha and beta chains. These are assembled anti-parallel to give a heterodimeric molecule in which the cysteine-rich centers are linked by five disulfide bridges and are flanked by two predicted coiled-coil alpha-helices and three predicted amphipathic alpha-helices. Clusterin is a heavily N-glycosylated protein.

Across a broad range of species clusterin shows 70% to 80% of sequence homology. It is ubiquitously expressed in most mammalian tissues and can be found in plasma, milk, urine, cerebrospinal fluid and semen.

It is able to bind and form complexes with numerous partners such as immunoglobulins, lipids, heparin, bacteria, complement components, paraoxonase, beta amyloid, leptin and others. Clusterin has been ascribed a plethora of functions such as phagocyte recruitment, aggregation induction, complement attack prevention, apoptosis inhibition, membrane remodelling, lipid transport, hormone transport and/or scavenging, matrix metalloproteinase inhibition.

A detailed mechanism of clusterin has not been defined. One tempting hypothesis says that clusterin is an extracellular chaperone protecting cells from stress induced by degraded and misfolded protein precipitates.Clus­terin is up- or downregulated on the mRNA or protein level in many pathological and clinically relevant situations including cancer, organ regeneration, infection, Alzheimer disease, retinitis pigmentosa, myocardial infarction, renal tubular damage, autoimmunity and others.

Product References (1)

References

  • Zhang F, Sha J, Wood TG, Galindo CL, Garner HR, Burkart MF, Suarez G, Sierra JC, Agar SL, Peterson JW, Chopra AK. Alteration in the activation state of new inflammation-associated targets by phospholipase A2-activating protein (PLAA). Cell Signal. 2008 May;20(5):844-61. doi: 10.1016/j.cellsig.2008.01.004. Epub 2008 Jan 17. PubMed PMID: 18291623. PubMed CentralPMCID: PMC2729133. See more on PubMed
Summary References (13)

References to Clusterin

  • Choi-Miura NH, Oda T: Relationship between multifunctional protein Clusterin and Alzheimer disease. Neurobiol. Aging 1996; 17(5): 717–722
  • Newkirk MM, Apostolakos P, Neville C and Fortin PR: Systemic lupus erythematosus, a disease associated with low levels of Clusterin/ApoJ, and anti-inflammatory protein. J. Rheumatol.1999; 3:597–603
  • Morrissey C, Lakins J, Moquin A, Hussain M, Tenniswood M: An antigen capture assay for the measurement of serum Clusterin concentrations. J. Biochen. Biophys. Methods 2001; 48:13–21
  • Trougakos IP, Poulakou M, Stathatos M, Chalikia A, Melidonis A, Gonos ES: Serum levels of the senescence biomarker Clusterin/apolipoprotein J increase significantly in diabetes type II and during development of coronary heart disease or at myocardial infarction. Ex. Gerontology 2002; 37: 1175–1187
  • Jones SE, Jomary C: Molecules in focus Clusterin. The International J. of Bioch. & Cell Biol. 2002; 34:427–431
  • Hidaka S, Kränzlin B, Gretz N, Witzgall R: Urinary Clusterin levels in the rat correlate with the severity of tubular damage and may help to differentiate between glomerular and tubular injuries. Cell Tissue Res. 2002; 310:289–296
  • Chen X, Halberg RB, Ehrhardt WM, Torrealba J and Dove WF: Clusterin as a biomarker in murine and human intestinal neoplasia. PNAS 2003; 100:9530–9535
  • Zhang LY, Ying WT, Mao YS, He HZ, Liu Y, Wang HX, Liu F, Wang K, Zhang DC, Wang Y, Wu M, Qian XH and Zhao XH: Loss of Clusterin both in serum and tissue correlates with the tumorogenesis of esophageal squamous cell carcinoma via proteomics approaches. World J Gastroenterol 2003; 9:650–654
  • Wang L, Erling P, Bengtsson AA, Truedsson L, Sturfelt G, Erlinge D: Transcriptional down-regulation of the platelet ADP receptory P2Y12 and Clusterin in patients with systemic lupus erythematosus. J. of Thromb. And Haemost. 2004; 2:1436–1442
  • Patel NV, Wei M, Wong A, Finch CE, Morgan TE: Progressive changes in regulation of apolipoproteins E and J in glial cultures during postnatal development and aging. Neuroscience Letters 2004; 371:199–204
  • Kim BM, Kim SY, Lee S, Shin YJ, Min BH, Bendayan M, Park IS: Clusterin induces differentiation of pancreatic duct calls into insulin-secreting cells. Diabetologia 2006; 49:311–320
  • Kruger S, Mahnken A, Kausch I, Feller AC: Value of Clusterin immunoreactivity as a predictive factor in muscle-invasive urothelial bladder carcinoma. Urology 2006; 67:105–109
  • Stejskal D, Fiala R: Evaluation of serum and urine Clusterin as a potential tumor marker for urinary bladder cancer. Neoplasma 2006; 53:343–34
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít